(data stored in ACNUC7421 zone)

EMBL: CP002160.PE13

CP002160.PE13        Location/Qualifiers
FT   CDS             21223..22503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0013"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG: cbl:CLK_3156
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49804"
FT                   /db_xref="GOA:D9SML9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML9"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADL49804.1"
FT                   /translation="MLDLKRIRSNKDEIKAALSNRGEDFDLTVIDKVVELDESRRAILV
FT                   EVENKKNQRNTESALVPKLKKAGEDASEVLQRMKSLSDEIKELDDKVRAIDEEIEYIML
FT                   RIPNIPNPLVPDGATDEDNLEIKRWGEPRKFENEPKAHWDLGVDLKILDFERAGKVTGS
FT                   RFTFYRGLGARLERALISYFLDTHVDINGYTEIMPPLMANRNSMKGTGQLPKFEEDAFT
FT                   IQNNGYFLIPTAEVPVTNYYRDEILVGEELPIKHVAYSACFRSEAGSAGRDTRGLVRQH
FT                   QFNKVELVKFTKQEQSYEELDKLVKDAESILEGLGLPYRKVRICKGDLGFTAALKYDLE
FT                   VWMPSYNKYVEISSCSNFEDFQARRANIKYREDAKAKPQFVHTLNGSGLAVGRTFAAIL
FT                   ENYQNEDGSVTIPEVLRKYMGGVEVIK"
     MLDLKRIRSN KDEIKAALSN RGEDFDLTVI DKVVELDESR RAILVEVENK KNQRNTESAL        60
     VPKLKKAGED ASEVLQRMKS LSDEIKELDD KVRAIDEEIE YIMLRIPNIP NPLVPDGATD       120
     EDNLEIKRWG EPRKFENEPK AHWDLGVDLK ILDFERAGKV TGSRFTFYRG LGARLERALI       180
     SYFLDTHVDI NGYTEIMPPL MANRNSMKGT GQLPKFEEDA FTIQNNGYFL IPTAEVPVTN       240
     YYRDEILVGE ELPIKHVAYS ACFRSEAGSA GRDTRGLVRQ HQFNKVELVK FTKQEQSYEE       300
     LDKLVKDAES ILEGLGLPYR KVRICKGDLG FTAALKYDLE VWMPSYNKYV EISSCSNFED       360
     FQARRANIKY REDAKAKPQF VHTLNGSGLA VGRTFAAILE NYQNEDGSVT IPEVLRKYMG       420
     GVEVIK                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page