(data stored in ACNUC7421 zone)

EMBL: CP002160.PE131

CP002160.PE131       Location/Qualifiers
FT   CDS             209991..210509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0133"
FT                   /product="spore maturation protein B"
FT                   /note="SpmB; KEGG: cac:CAC0470 spore maturation protein B
FT                   (gene SpmB)"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49922"
FT                   /db_xref="GOA:D9SNQ1"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ1"
FT                   /inference="similar to AA sequence:KEGG:CAC0470"
FT                   /protein_id="ADL49922.1"
FT                   /translation="MSYIFASIIPILICGIVIYGIVHKVKVYEVFVEGAKDGLSISVKI
FT                   FPYLLAMLLSISIFRSSGAMDYLITFISPIVGLIGLPAEIVPLILIKPLSGSGALGVFA
FT                   EILKNYGPDTFIGLVASIIMGGTETIFYTITVYYGAINIKKIRHTLWAAVMADITAIIV
FT                   ALVIARFIY"
     MSYIFASIIP ILICGIVIYG IVHKVKVYEV FVEGAKDGLS ISVKIFPYLL AMLLSISIFR        60
     SSGAMDYLIT FISPIVGLIG LPAEIVPLIL IKPLSGSGAL GVFAEILKNY GPDTFIGLVA       120
     SIIMGGTETI FYTITVYYGA INIKKIRHTL WAAVMADITA IIVALVIARF IY               172
//

If you have problems or comments...

PBIL Back to PBIL home page