(data stored in ACNUC7421 zone)

EMBL: CP002160.PE134

CP002160.PE134       Location/Qualifiers
FT   CDS             211734..211937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0136"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: nth:Nther_0740 transcriptional regulator;
FT                   PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49925"
FT                   /db_xref="GOA:D9SNQ4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADL49925.1"
FT                   /translation="MRVNKIKTARVEKGITQEELADMIKVTRQTISLIESGKYNPTLKL
FT                   CISICLALGKTLNDLFWEEEIK"
     MRVNKIKTAR VEKGITQEEL ADMIKVTRQT ISLIESGKYN PTLKLCISIC LALGKTLNDL        60
     FWEEEIK                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page