(data stored in ACNUC7421 zone)

EMBL: CP002160.PE135

CP002160.PE135       Location/Qualifiers
FT   CDS             211934..212383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcu:BCAH820_2065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49926"
FT                   /db_xref="GOA:D9SNQ5"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ5"
FT                   /inference="similar to AA sequence:KEGG:BCAH820_2065"
FT                   /protein_id="ADL49926.1"
FT                   /translation="MKLFKSKYDDERINSLIYKASFNTVVLLQIALLGDFIVRTLILNH
FT                   PLRESISSLIIFIIGAIYMCTCIIINGAYGTMVSENKFNLKRKRVYIYLIGSAFVAIMI
FT                   NITDGDDFYSKKGLLKFGFDFVAFFILTYFSSSALNKLLTNKKGR"
     MKLFKSKYDD ERINSLIYKA SFNTVVLLQI ALLGDFIVRT LILNHPLRES ISSLIIFIIG        60
     AIYMCTCIII NGAYGTMVSE NKFNLKRKRV YIYLIGSAFV AIMINITDGD DFYSKKGLLK       120
     FGFDFVAFFI LTYFSSSALN KLLTNKKGR                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page