(data stored in ACNUC7421 zone)

EMBL: CP002160.PE136

CP002160.PE136       Location/Qualifiers
FT   CDS             212517..212729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctt:CtCNB1_0702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49927"
FT                   /db_xref="GOA:D9SNQ6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ6"
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_0702"
FT                   /protein_id="ADL49927.1"
FT                   /translation="MKAKSNLFGSMIIWFFIGFLTEVFQRVFKIGQAVDIYGNNFMSTS
FT                   IFRGIFTAVVIGIPYYFILRKRNKN"
     MKAKSNLFGS MIIWFFIGFL TEVFQRVFKI GQAVDIYGNN FMSTSIFRGI FTAVVIGIPY        60
     YFILRKRNKN                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page