(data stored in ACNUC7421 zone)

EMBL: CP002160.PE139

CP002160.PE139       Location/Qualifiers
FT   CDS             216472..218280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0141"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: cac:CAC2943
FT                   integrin-like repeat-containing cell wall-associated
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49930"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNQ9"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADL49930.1"
FT                   /translation="MKKLRGLICLTTTLGVVSGFLPLITAQDVQAAQTVTTTTPYISTK
FT                   QLSNSKVDVTGDGKADYVTVWNNGGKRNIATYVANGNGTFKELVNTVSSGSFTADVVGR
FT                   DTGIFADVTGDGKADYIVPWNNNGKRSFATYVAKSDGTFNEYVNSSSEGSFITDTMGID
FT                   IGVFADVTGDGKADYIVTWNNNGKRTLTTYVAKGDGTFSTFVNTSSSGSFTADTVGRDT
FT                   GIFTDVNGDGKTDYVVTWNNNGKRSFTTYLAKGDGTFSEFVNTASGGTFMLDTLGRDTG
FT                   IFADVTGDGKADYIVPWNNNGKRSFATYVGKADGTFNELVSSSSVGTFKADSIGRDTGT
FT                   FTDVTGDGKVDYIVSWNNGGKRSFATYVGKADGTFNELVSSSSAGTFTADSMGKDVGIF
FT                   ADVTGDGKADYVVPWNNNGKRSFATYVANANGTFNELVTTSSNGTFLADKIGRDLGGLV
FT                   GDRDYSINDTSMFVVKTVTIVKTDAEILIDYAKQFLGLPYKTNGTTPDGFDCSGFVQYV
FT                   YKNALNIDVSRTTYTQVGKGYDVGTDIAKLQLGDLVFFGDYEAPHHVGIYVGNGKCIHS
FT                   PTEGQSIKYTNLSDFGDFSRARRIIG"
     MKKLRGLICL TTTLGVVSGF LPLITAQDVQ AAQTVTTTTP YISTKQLSNS KVDVTGDGKA        60
     DYVTVWNNGG KRNIATYVAN GNGTFKELVN TVSSGSFTAD VVGRDTGIFA DVTGDGKADY       120
     IVPWNNNGKR SFATYVAKSD GTFNEYVNSS SEGSFITDTM GIDIGVFADV TGDGKADYIV       180
     TWNNNGKRTL TTYVAKGDGT FSTFVNTSSS GSFTADTVGR DTGIFTDVNG DGKTDYVVTW       240
     NNNGKRSFTT YLAKGDGTFS EFVNTASGGT FMLDTLGRDT GIFADVTGDG KADYIVPWNN       300
     NGKRSFATYV GKADGTFNEL VSSSSVGTFK ADSIGRDTGT FTDVTGDGKV DYIVSWNNGG       360
     KRSFATYVGK ADGTFNELVS SSSAGTFTAD SMGKDVGIFA DVTGDGKADY VVPWNNNGKR       420
     SFATYVANAN GTFNELVTTS SNGTFLADKI GRDLGGLVGD RDYSINDTSM FVVKTVTIVK       480
     TDAEILIDYA KQFLGLPYKT NGTTPDGFDC SGFVQYVYKN ALNIDVSRTT YTQVGKGYDV       540
     GTDIAKLQLG DLVFFGDYEA PHHVGIYVGN GKCIHSPTEG QSIKYTNLSD FGDFSRARRI       600
     IG                                                                      602
//

If you have problems or comments...

PBIL Back to PBIL home page