(data stored in ACNUC7421 zone)

EMBL: CP002160.PE140

CP002160.PE140       Location/Qualifiers
FT   CDS             218435..220438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbr:MONBRDRAFT_27322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49931"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR0"
FT                   /inference="similar to AA sequence:KEGG:MONBRDRAFT_27322"
FT                   /protein_id="ADL49931.1"
FT                   /translation="MKNLRIVSYLTTALVLGGAIFPAVTAKNVQAATKTISYISTKPLS
FT                   ASKADVTGDGKADYVAVWNNSGKRNIATYVAKGDGTFNELINTVSSGNFTSDAVGRDTG
FT                   IFADVTGDGKADYIVSWNNNGKRTLATYVAKGDGTFNEYVNTFSAGTFTADTMESDTGT
FT                   FTDVNGDRKADYVVTWNNSGKRSFTTYLAKGDGTFNEFINTASSGSFTADTVGRDTGIF
FT                   TDVTGDGKTDYVVTWNNNGKRSFTTYVAKGDGTFNEFVNTSSGGTFMLDTLGRDTGIFA
FT                   DVTGDGKADYIVPWNNNGKRSFATYVGKADGTFNELVSSSSTGTFTADSIGRDTGTFTD
FT                   VTGDGKVDYVVSWNNSGKRSFATYVGKADGTFNELVSSSSAGTFTADSMGKDVGIFTDV
FT                   TGDGRADYVVPWNNNGKRSFATYVGKADGKFNELVTTSSNGTFLADKVGRDLGVLAGDR
FT                   DSSINDTRVFVEQITLADTISPNSGTGFLYKYEAELISKINFINYNKFGTELDTIKSIY
FT                   INNKSTYDNIASKTNIPSALICALHYRESGCNFGTYLHNGQPLGQITTKVPVGLYFTDF
FT                   ASAAIDALTRKSDIRDDYGLKSSSVDMAAMAGFAEQYNGTGYHDYHSMPSPYVFNGTNV
FT                   YTSGKYTSDGNFNQYVIDVQPGVYIILKKLMG"
     MKNLRIVSYL TTALVLGGAI FPAVTAKNVQ AATKTISYIS TKPLSASKAD VTGDGKADYV        60
     AVWNNSGKRN IATYVAKGDG TFNELINTVS SGNFTSDAVG RDTGIFADVT GDGKADYIVS       120
     WNNNGKRTLA TYVAKGDGTF NEYVNTFSAG TFTADTMESD TGTFTDVNGD RKADYVVTWN       180
     NSGKRSFTTY LAKGDGTFNE FINTASSGSF TADTVGRDTG IFTDVTGDGK TDYVVTWNNN       240
     GKRSFTTYVA KGDGTFNEFV NTSSGGTFML DTLGRDTGIF ADVTGDGKAD YIVPWNNNGK       300
     RSFATYVGKA DGTFNELVSS SSTGTFTADS IGRDTGTFTD VTGDGKVDYV VSWNNSGKRS       360
     FATYVGKADG TFNELVSSSS AGTFTADSMG KDVGIFTDVT GDGRADYVVP WNNNGKRSFA       420
     TYVGKADGKF NELVTTSSNG TFLADKVGRD LGVLAGDRDS SINDTRVFVE QITLADTISP       480
     NSGTGFLYKY EAELISKINF INYNKFGTEL DTIKSIYINN KSTYDNIASK TNIPSALICA       540
     LHYRESGCNF GTYLHNGQPL GQITTKVPVG LYFTDFASAA IDALTRKSDI RDDYGLKSSS       600
     VDMAAMAGFA EQYNGTGYHD YHSMPSPYVF NGTNVYTSGK YTSDGNFNQY VIDVQPGVYI       660
     ILKKLMG                                                                 667
//

If you have problems or comments...

PBIL Back to PBIL home page