(data stored in ACNUC7421 zone)

EMBL: CP002160.PE144

CP002160.PE144       Location/Qualifiers
FT   CDS             226291..227244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0146"
FT                   /product="Proteinase inhibitor I42, chagasin"
FT                   /note="PFAM: Proteinase inhibitor I42, chagasin; Dockerin
FT                   type 1; KEGG: cbt:CLH_1555 cell wall binding repeat domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49935"
FT                   /db_xref="GOA:D9SNR4"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR4"
FT                   /inference="protein motif:PFAM:PF09394"
FT                   /protein_id="ADL49935.1"
FT                   /translation="MLKKKRTFISKILLASMCVSIVPATVALAEENAVIQENVSNDIEV
FT                   IPMFGEPQATTSLALKSNASTGYSWKYTVVQGDSIVESSKSYMPDDTSGTIDGSGGTDI
FT                   WIFKSLKEGSTTLRFEYSRSWEKDEVETKEFVITVDSKMNTTVKETTKGTAQIQLKANP
FT                   TTGCSWRYSVVQGESIEEASTLYVTDAVPADIDGSGGTDIWVFKGLKEGSTLLKFEYLQ
FT                   SWLENAFYTKYFNLAVDKDLNVTITEVAEPPKDGPSSQINYDINGDSKVSLIDLVLLKK
FT                   YLLDNTVVINKDAADINRDGQINAIDVALLRKVLLT"
     MLKKKRTFIS KILLASMCVS IVPATVALAE ENAVIQENVS NDIEVIPMFG EPQATTSLAL        60
     KSNASTGYSW KYTVVQGDSI VESSKSYMPD DTSGTIDGSG GTDIWIFKSL KEGSTTLRFE       120
     YSRSWEKDEV ETKEFVITVD SKMNTTVKET TKGTAQIQLK ANPTTGCSWR YSVVQGESIE       180
     EASTLYVTDA VPADIDGSGG TDIWVFKGLK EGSTLLKFEY LQSWLENAFY TKYFNLAVDK       240
     DLNVTITEVA EPPKDGPSSQ INYDINGDSK VSLIDLVLLK KYLLDNTVVI NKDAADINRD       300
     GQINAIDVAL LRKVLLT                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page