(data stored in ACNUC7421 zone)

EMBL: CP002160.PE145

CP002160.PE145       Location/Qualifiers
FT   CDS             227369..228325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0147"
FT                   /product="Proteinase inhibitor I42, chagasin"
FT                   /note="PFAM: Proteinase inhibitor I42, chagasin; Dockerin
FT                   type 1; KEGG: cbt:CLH_1555 cell wall binding repeat domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49936"
FT                   /db_xref="GOA:D9SNR5"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR5"
FT                   /inference="protein motif:PFAM:PF09394"
FT                   /protein_id="ADL49936.1"
FT                   /translation="MLKKKRTFISKILLVSMCASIVPATVALAGENAVVKKSKSNEIQI
FT                   IPMPGNVKESTSISLKSNATTGYSWKYTVVQGDSIIQTLKSYRPDDTSGTIDGSGGTDT
FT                   WTFKGSKEGSTTLRFEYSRSWEESPVDTREFIITVDGDMNMTVKETTKGTASIQLRSDT
FT                   TTEACSWRYSVVQGDSIVESSKEFIEYPVWTGIYGSGGRNIWVFKGLKEGSTTLKFEYL
FT                   RPTEGDVAEIRDFNLTVDKDLNVSVTELSDQSKAGPSSQRVADINGDGNVNLIDLALLK
FT                   KYLKDNTIGISKYVGDLNRDGQINSTDVNLLKMALLR"
     MLKKKRTFIS KILLVSMCAS IVPATVALAG ENAVVKKSKS NEIQIIPMPG NVKESTSISL        60
     KSNATTGYSW KYTVVQGDSI IQTLKSYRPD DTSGTIDGSG GTDTWTFKGS KEGSTTLRFE       120
     YSRSWEESPV DTREFIITVD GDMNMTVKET TKGTASIQLR SDTTTEACSW RYSVVQGDSI       180
     VESSKEFIEY PVWTGIYGSG GRNIWVFKGL KEGSTTLKFE YLRPTEGDVA EIRDFNLTVD       240
     KDLNVSVTEL SDQSKAGPSS QRVADINGDG NVNLIDLALL KKYLKDNTIG ISKYVGDLNR       300
     DGQINSTDVN LLKMALLR                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page