(data stored in ACNUC7421 zone)

EMBL: CP002160.PE148

CP002160.PE148       Location/Qualifiers
FT   CDS             complement(235504..238236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0150"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: E1-E2 ATPase-associated
FT                   domain protein; cation transporting ATPase domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   cbf:CLI_1616 hypothetical protein; SMART: cation
FT                   transporting ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49939"
FT                   /db_xref="GOA:D9SNR8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR8"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ADL49939.1"
FT                   /translation="MTSQQNQKFYGLTTAKAKELQKQFGKNELTKKEKDSFFLKLLQVL
FT                   KEPMFLLLIIAAIIYFILGEPRDGAIMLVFVIGIIGIDVFQEWKTDKTLNALKDLSAPH
FT                   ITVLRDDKEQVLNSADLVPGDIMYIKEGVKIPADGFVLKASTLCIDESSLTGEAEGVWK
FT                   ISMDKLQQEKKTILSNESISFASSIDKAQQEKDTIAKLQQRKEAILTSENVNLASTINK
FT                   IEQKEDTINPNSVSSEYAADNKDYWRRDYCYAGTLVTQGTGVILVDKIGPATEYGKIGQ
FT                   SIISAPETPTPLQKQVGKLVKTCAAIAALLFVLVGTVTFFNIPDHKLLDRLIESILSGV
FT                   TLAMAMIPEEFPVILTVFLSMGAWRLAKKHSLVRKLPSVETLGAVSVLCVDKTGTITMN
FT                   QMTVKETWCFTKDKRLLNQTMGLGCKYDAYDPMEKAILSYCQTQGLSKDSLFNGELIKE
FT                   YAFTNESKIMGHVWEKGNEIIIAAKGSPERLLNLCCLSTTERKLAEENVIKLSRKGLRV
FT                   IAIAQRILSIDDTIPNSLKNCNLQLCGMVGFTDPPRENINKSIETCTKAGVRVVMITGD
FT                   NGITASSIAKQINMPNNDKIITGDQLNKFNDEELKERIKTVSIFSRVIPEHKMRIVKAF
FT                   KDSGEIVAMTGDGVNDAAALKYADIGIAMGKRGSEVSREAADLILLDDNFSTIVDTIKD
FT                   GRRIYHNIRKAVGYVFSIHIPIAVSSLLAPFLGITPANLLLLPLHVVLLELVIDPTCSI
FT                   ILERQPAEEDIMDHPPRAPKEKILTTKTFIKSILQGLAIFIASFGTYYTSLNINPDNAP
FT                   VARAMGLTVILVANILLVHVNSSETEFAMKSFVHLIKDKIMWVYSLGIITSLGLILYSP
FT                   LSDFLKLTPLTFNQLLISILIAIVSVMWYEIVKLIKKHL"
     MTSQQNQKFY GLTTAKAKEL QKQFGKNELT KKEKDSFFLK LLQVLKEPMF LLLIIAAIIY        60
     FILGEPRDGA IMLVFVIGII GIDVFQEWKT DKTLNALKDL SAPHITVLRD DKEQVLNSAD       120
     LVPGDIMYIK EGVKIPADGF VLKASTLCID ESSLTGEAEG VWKISMDKLQ QEKKTILSNE       180
     SISFASSIDK AQQEKDTIAK LQQRKEAILT SENVNLASTI NKIEQKEDTI NPNSVSSEYA       240
     ADNKDYWRRD YCYAGTLVTQ GTGVILVDKI GPATEYGKIG QSIISAPETP TPLQKQVGKL       300
     VKTCAAIAAL LFVLVGTVTF FNIPDHKLLD RLIESILSGV TLAMAMIPEE FPVILTVFLS       360
     MGAWRLAKKH SLVRKLPSVE TLGAVSVLCV DKTGTITMNQ MTVKETWCFT KDKRLLNQTM       420
     GLGCKYDAYD PMEKAILSYC QTQGLSKDSL FNGELIKEYA FTNESKIMGH VWEKGNEIII       480
     AAKGSPERLL NLCCLSTTER KLAEENVIKL SRKGLRVIAI AQRILSIDDT IPNSLKNCNL       540
     QLCGMVGFTD PPRENINKSI ETCTKAGVRV VMITGDNGIT ASSIAKQINM PNNDKIITGD       600
     QLNKFNDEEL KERIKTVSIF SRVIPEHKMR IVKAFKDSGE IVAMTGDGVN DAAALKYADI       660
     GIAMGKRGSE VSREAADLIL LDDNFSTIVD TIKDGRRIYH NIRKAVGYVF SIHIPIAVSS       720
     LLAPFLGITP ANLLLLPLHV VLLELVIDPT CSIILERQPA EEDIMDHPPR APKEKILTTK       780
     TFIKSILQGL AIFIASFGTY YTSLNINPDN APVARAMGLT VILVANILLV HVNSSETEFA       840
     MKSFVHLIKD KIMWVYSLGI ITSLGLILYS PLSDFLKLTP LTFNQLLISI LIAIVSVMWY       900
     EIVKLIKKHL                                                              910
//

If you have problems or comments...

PBIL Back to PBIL home page