(data stored in ACNUC7421 zone)

EMBL: CP002160.PE149

CP002160.PE149       Location/Qualifiers
FT   CDS             239343..240200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0152"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cpy:Cphy_3127
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49940"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNR9"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADL49940.1"
FT                   /translation="MDIAVLSDIHGNYIALKRCLEYAFSQNISTFFFLGDYIGELAYPE
FT                   RTMKILYDLNERYKCYFIKGNKEDYWLNYRANGEKGWKDKDSTSGSLLYAYKSLTARDL
FT                   DFFAQLQSVQEITVSGMAPITICHGSPDKINEKMLPDDDRTIQIINGVETSIILCGHSH
FT                   VQRKIVHNEKCILNPGSVGVPLFSEGNTQFLILHGNDGVWLEEFISLEYDVLRVIRDMH
FT                   EAKLYEHAPYWSMITETILRGGNTSHSKVLTRAMELCREETGDCVWPNIPEKCWEQAVN
FT                   ELIL"
     MDIAVLSDIH GNYIALKRCL EYAFSQNIST FFFLGDYIGE LAYPERTMKI LYDLNERYKC        60
     YFIKGNKEDY WLNYRANGEK GWKDKDSTSG SLLYAYKSLT ARDLDFFAQL QSVQEITVSG       120
     MAPITICHGS PDKINEKMLP DDDRTIQIIN GVETSIILCG HSHVQRKIVH NEKCILNPGS       180
     VGVPLFSEGN TQFLILHGND GVWLEEFISL EYDVLRVIRD MHEAKLYEHA PYWSMITETI       240
     LRGGNTSHSK VLTRAMELCR EETGDCVWPN IPEKCWEQAV NELIL                       285
//

If you have problems or comments...

PBIL Back to PBIL home page