(data stored in ACNUC7421 zone)

EMBL: CP002160.PE15

CP002160.PE15        Location/Qualifiers
FT   CDS             complement(24327..24701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lin:lin0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49806"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM1"
FT                   /inference="similar to AA sequence:KEGG:lin0130"
FT                   /protein_id="ADL49806.1"
FT                   /translation="MRKFFKFIITSIFIIIAIDILSRTATLNWSYLKVNDELYVLCTYN
FT                   IQNLDETDKFTKIGTIESKTNIFIKPIFNYSSNSFRKGSEVYKTDDNQIAVKQNNKFYV
FT                   LSSTQSEGWGNGIMVNPYLD"
     MRKFFKFIIT SIFIIIAIDI LSRTATLNWS YLKVNDELYV LCTYNIQNLD ETDKFTKIGT        60
     IESKTNIFIK PIFNYSSNSF RKGSEVYKTD DNQIAVKQNN KFYVLSSTQS EGWGNGIMVN       120
     PYLD                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page