(data stored in ACNUC7421 zone)

EMBL: CP002160.PE153

CP002160.PE153       Location/Qualifiers
FT   CDS             242742..243257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0156"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hor:Hore_00330 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49944"
FT                   /db_xref="GOA:D9SNS3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL49944.1"
FT                   /translation="MIKFQLLTKENMAENALDNYDRLQNVRRVYRKIDSEYMLVEDVGI
FT                   MDWSFERKQAVAKALISDDYITFGAIREDEIVGFASIEKQLQGKYIVLDMMQVSRKYRG
FT                   KGMGRTLFQLVKEKAKEMGAKQLYISACASEETIEFYKSMGCKITDNPIKKIAEDEPFD
FT                   LQMVCDVD"
     MIKFQLLTKE NMAENALDNY DRLQNVRRVY RKIDSEYMLV EDVGIMDWSF ERKQAVAKAL        60
     ISDDYITFGA IREDEIVGFA SIEKQLQGKY IVLDMMQVSR KYRGKGMGRT LFQLVKEKAK       120
     EMGAKQLYIS ACASEETIEF YKSMGCKITD NPIKKIAEDE PFDLQMVCDV D                171
//

If you have problems or comments...

PBIL Back to PBIL home page