(data stored in ACNUC7421 zone)

EMBL: CP002160.PE155

CP002160.PE155       Location/Qualifiers
FT   CDS             complement(243885..244796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0158"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="PFAM: Tetratricopeptide TPR_1 repeat-containing
FT                   protein; KEGG: mmx:MmarC6_1787 TPR repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49946"
FT                   /db_xref="GOA:D9SNS5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS5"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADL49946.1"
FT                   /translation="MSKSKVRRNVIIIISSIIIAVAAISIPGYMLLRVPLLENKINQAI
FT                   NNAEYEKVIELSDKLYGYGKDPLFALTKKAYAQAKLGKNQEVLDTYNELVKIDQNNSEI
FT                   YNQMGILYNDVFKDYEKALGAFDNAINLNSTDATYYSNKGLSLQWLNRDEEAVAAFKKS
FT                   IEIDPSLAYVYHYLGLSYCTLKNFDEAIPALAKATELNPQNSNAFVSLGNSYLEKNLSN
FT                   EAIAAFDKAIELDKKDADAFVGKGLALFNLEKYQDAIGVFDLALALDDKSKAAYTGKGN
FT                   CLSALFKDAEARECYDKAKAIQ"
     MSKSKVRRNV IIIISSIIIA VAAISIPGYM LLRVPLLENK INQAINNAEY EKVIELSDKL        60
     YGYGKDPLFA LTKKAYAQAK LGKNQEVLDT YNELVKIDQN NSEIYNQMGI LYNDVFKDYE       120
     KALGAFDNAI NLNSTDATYY SNKGLSLQWL NRDEEAVAAF KKSIEIDPSL AYVYHYLGLS       180
     YCTLKNFDEA IPALAKATEL NPQNSNAFVS LGNSYLEKNL SNEAIAAFDK AIELDKKDAD       240
     AFVGKGLALF NLEKYQDAIG VFDLALALDD KSKAAYTGKG NCLSALFKDA EARECYDKAK       300
     AIQ                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page