(data stored in ACNUC7421 zone)

EMBL: CP002160.PE159

CP002160.PE159       Location/Qualifiers
FT   CDS             complement(247522..249456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyc:PCC7424_1250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49950"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNS9"
FT                   /inference="similar to AA sequence:KEGG:PCC7424_1250"
FT                   /protein_id="ADL49950.1"
FT                   /translation="MYYALHGLNNFEDKTIPPGSVHVSNGYGEIILRDVYDFPALAFTL
FT                   DKDKIKGVALNDLGKLAIMYGIITVYNVEIHTVEPFYDYIPNPVLSTIPNPSSSPIPGP
FT                   ILNPVPDPVPSPVEDLVFDEKFYADKYPDLKTRFGYDRVKLFKHWKTSGIKEGRTFSCV
FT                   FDPDYYLKHNSDVAKAVGANNYEGAYQHFITSGYNEGRRSSPIYDGIYYKNCYSDLKTY
FT                   DFYKLIYHFLTYGIHEGRSACLNFEPIVYAIRYPDLFKNFGNLDYKPYFTHYLISGIRE
FT                   GRSGLYDYNFIPNPIENLIFDEKFYADKYPDLKANLGYNKAKLFMHWKTTGIKEGRTSS
FT                   YVFDPDYYLKNNSDVAKAVGANNYKGAYEHFITSGYNEGRKSSPIYHGSYYQNCYSDLK
FT                   THDFYKLIYHFITYGIHESRNACLNFEPIVYAIRYPDLFKALGNSDYKPYFTHYLISGI
FT                   REGRSGLYDYNFIPNPIENLIFDEKFYADKYPDLKAKFGYDRARLFMHWKVSGIKEGRT
FT                   SSYVFDPVYYLKNNSDVSNAVGANNYEGAYQHFITSGYNEGRRSSPIYDGSYYQNYNPE
FT                   LRVYDFYKLIEHFLVHGIHEGRRACSNFGAKVYVARYSDLFKNFGTSDYKPYFTHYLIS
FT                   GIKEGRLSY"
     MYYALHGLNN FEDKTIPPGS VHVSNGYGEI ILRDVYDFPA LAFTLDKDKI KGVALNDLGK        60
     LAIMYGIITV YNVEIHTVEP FYDYIPNPVL STIPNPSSSP IPGPILNPVP DPVPSPVEDL       120
     VFDEKFYADK YPDLKTRFGY DRVKLFKHWK TSGIKEGRTF SCVFDPDYYL KHNSDVAKAV       180
     GANNYEGAYQ HFITSGYNEG RRSSPIYDGI YYKNCYSDLK TYDFYKLIYH FLTYGIHEGR       240
     SACLNFEPIV YAIRYPDLFK NFGNLDYKPY FTHYLISGIR EGRSGLYDYN FIPNPIENLI       300
     FDEKFYADKY PDLKANLGYN KAKLFMHWKT TGIKEGRTSS YVFDPDYYLK NNSDVAKAVG       360
     ANNYKGAYEH FITSGYNEGR KSSPIYHGSY YQNCYSDLKT HDFYKLIYHF ITYGIHESRN       420
     ACLNFEPIVY AIRYPDLFKA LGNSDYKPYF THYLISGIRE GRSGLYDYNF IPNPIENLIF       480
     DEKFYADKYP DLKAKFGYDR ARLFMHWKVS GIKEGRTSSY VFDPVYYLKN NSDVSNAVGA       540
     NNYEGAYQHF ITSGYNEGRR SSPIYDGSYY QNYNPELRVY DFYKLIEHFL VHGIHEGRRA       600
     CSNFGAKVYV ARYSDLFKNF GTSDYKPYFT HYLISGIKEG RLSY                        644
//

If you have problems or comments...

PBIL Back to PBIL home page