(data stored in ACNUC7421 zone)

EMBL: CP002160.PE161

CP002160.PE161       Location/Qualifiers
FT   CDS             250456..250839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_3847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49952"
FT                   /db_xref="InterPro:IPR025059"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNT1"
FT                   /inference="similar to AA sequence:KEGG:BcerKBAB4_3847"
FT                   /protein_id="ADL49952.1"
FT                   /translation="MTKKYILIISIIVLMFSFSGCEFVVGPGSADYSYKLSGNYELYHA
FT                   GYTSIYKGDYEIVVTAEVKKIAWDDLYILARQEDDDKINYFIIDVNQDKVLGPLSEEDF
FT                   NKKRDELKIDKDLKLKDPSKYRK"
     MTKKYILIIS IIVLMFSFSG CEFVVGPGSA DYSYKLSGNY ELYHAGYTSI YKGDYEIVVT        60
     AEVKKIAWDD LYILARQEDD DKINYFIIDV NQDKVLGPLS EEDFNKKRDE LKIDKDLKLK       120
     DPSKYRK                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page