(data stored in ACNUC7421 zone)

EMBL: CP002160.PE172

CP002160.PE172       Location/Qualifiers
FT   CDS             complement(262518..263027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0176"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: asu:Asuc_0075
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49963"
FT                   /db_xref="GOA:D9SNU2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADL49963.1"
FT                   /translation="MIERTNASNIFVCECLQAALLRLLKTKPLENISILELVKIAGVSR
FT                   NSFYRNYNNLEEIIGEYLMKESQKWWDSYSKSEDKNLTKCLFEHFITLKDIISALYQSN
FT                   HSHLMMQHIFQCTISGKSCSAQESYQRAIIAGSTWGLFDEWVKRGMKDSPEEMSRFLES
FT                   GWHERT"
     MIERTNASNI FVCECLQAAL LRLLKTKPLE NISILELVKI AGVSRNSFYR NYNNLEEIIG        60
     EYLMKESQKW WDSYSKSEDK NLTKCLFEHF ITLKDIISAL YQSNHSHLMM QHIFQCTISG       120
     KSCSAQESYQ RAIIAGSTWG LFDEWVKRGM KDSPEEMSRF LESGWHERT                   169
//

If you have problems or comments...

PBIL Back to PBIL home page