(data stored in ACNUC7421 zone)

EMBL: CP002160.PE173

CP002160.PE173       Location/Qualifiers
FT   CDS             263173..264075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0177"
FT                   /product="alpha/beta superfamily hydrolase"
FT                   /note="KEGG: lac:LBA1350 alpha/beta superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49964"
FT                   /db_xref="GOA:D9SNU3"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU3"
FT                   /inference="similar to AA sequence:KEGG:LBA1350"
FT                   /protein_id="ADL49964.1"
FT                   /translation="MGKIIKRGILVLLILIAAITIWILITLGKVGMGPCKFLLYNKKPV
FT                   LLSEQKFAIAEKEFSCVVNGEKISGTIYIPEDERRSREILIISPGFNSTEAMLASKAKS
FT                   FAISGTPAVVFDFRGGSSSGKSEGDSTNMSISTEMSDLNAVIGYVQGLEWVNKEKIYLL
FT                   GESMGGLVSALTAAEHKDIAGLVLCFPALDKAESTRKTFSNMDKIPDTINMFGLLTGKK
FT                   LWQELYEMDVYEKIKKYTGPVIIMHGTKDPAVDLSYSEKANNVYTNSQLFVVEGAGHGF
FT                   NGDDEKSVLKTIYAFIHKQ"
     MGKIIKRGIL VLLILIAAIT IWILITLGKV GMGPCKFLLY NKKPVLLSEQ KFAIAEKEFS        60
     CVVNGEKISG TIYIPEDERR SREILIISPG FNSTEAMLAS KAKSFAISGT PAVVFDFRGG       120
     SSSGKSEGDS TNMSISTEMS DLNAVIGYVQ GLEWVNKEKI YLLGESMGGL VSALTAAEHK       180
     DIAGLVLCFP ALDKAESTRK TFSNMDKIPD TINMFGLLTG KKLWQELYEM DVYEKIKKYT       240
     GPVIIMHGTK DPAVDLSYSE KANNVYTNSQ LFVVEGAGHG FNGDDEKSVL KTIYAFIHKQ       300
//

If you have problems or comments...

PBIL Back to PBIL home page