(data stored in ACNUC7421 zone)

EMBL: CP002160.PE174

CP002160.PE174       Location/Qualifiers
FT   CDS             264735..265067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0180"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="KEGG: dhd:Dhaf_1680 transcriptional regulator,
FT                   PadR-like family; manually curated; PFAM: transcriptional
FT                   regulator PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49965"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU4"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADL49965.1"
FT                   /translation="MSDLENITEMLKGVLEGCVLEIISHEEIYGYEITKRLNALGFSDV
FT                   VDGTVYTILVRLEKNKLVDIEKKPSDMGPPRKFFTLNEAGREELRRFWERWEFVSSKIN
FT                   ELKERK"
     MSDLENITEM LKGVLEGCVL EIISHEEIYG YEITKRLNAL GFSDVVDGTV YTILVRLEKN        60
     KLVDIEKKPS DMGPPRKFFT LNEAGREELR RFWERWEFVS SKINELKERK                  110
//

If you have problems or comments...

PBIL Back to PBIL home page