(data stored in ACNUC7421 zone)

EMBL: CP002160.PE175

CP002160.PE175       Location/Qualifiers
FT   CDS             265067..265414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0181"
FT                   /product="uncharacterized conserved protein UCP029876"
FT                   /note="PFAM: uncharacterized conserved protein UCP029876;
FT                   KEGG: gym:GYMC10_3365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49966"
FT                   /db_xref="InterPro:IPR008316"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU5"
FT                   /inference="protein motif:PFAM:PF06304"
FT                   /protein_id="ADL49966.1"
FT                   /translation="MSFWGKITGSDITKEMKVFESRAKKLPTDYQVAWEKISANLWSYS
FT                   DFTGRNLMPILDGVLGMLEETAADGESVQEVLGDDIKGFCSALVGEEGAKSFRDKWRKQ
FT                   LNDNIAKKLGK"
     MSFWGKITGS DITKEMKVFE SRAKKLPTDY QVAWEKISAN LWSYSDFTGR NLMPILDGVL        60
     GMLEETAADG ESVQEVLGDD IKGFCSALVG EEGAKSFRDK WRKQLNDNIA KKLGK            115
//

If you have problems or comments...

PBIL Back to PBIL home page