(data stored in ACNUC7421 zone)

EMBL: CP002160.PE176

CP002160.PE176       Location/Qualifiers
FT   CDS             265424..265774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0182"
FT                   /product="uncharacterized conserved protein UCP029876"
FT                   /note="PFAM: uncharacterized conserved protein UCP029876;
FT                   KEGG: dhd:Dhaf_1682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49967"
FT                   /db_xref="InterPro:IPR008316"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU6"
FT                   /inference="protein motif:PFAM:PF06304"
FT                   /protein_id="ADL49967.1"
FT                   /translation="MGIQDIIEGKKEWRAHMARVKALPKDYQIVYKEIQKYLFKIGLVE
FT                   LTDGIGLLSGIVDFFEEGAALGKGVLEVTGSDVATFCDDLIKDSKTYYDIYQESVDQEV
FT                   NKAMKKVIDKKK"
     MGIQDIIEGK KEWRAHMARV KALPKDYQIV YKEIQKYLFK IGLVELTDGI GLLSGIVDFF        60
     EEGAALGKGV LEVTGSDVAT FCDDLIKDSK TYYDIYQESV DQEVNKAMKK VIDKKK           116
//

If you have problems or comments...

PBIL Back to PBIL home page