(data stored in ACNUC7421 zone)

EMBL: CP002160.PE179

CP002160.PE179       Location/Qualifiers
FT   CDS             267569..268498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: str:Sterm_0531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49970"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNU9"
FT                   /inference="similar to AA sequence:KEGG:Sterm_0531"
FT                   /protein_id="ADL49970.1"
FT                   /translation="MKMSKKQFEVIRNWMYRNARPLDIARWKYHFENGNKDDVLAALSA
FT                   YQNPNGGFGYALEADSWNPNSSPIQTWCATEILYELGITDKNNEIVRNILSYLDSGKDF
FT                   QDGHWIAQIPTNDDYPHAEWWSYRENVIDQWGYNPTICLVGFILYFADKQSKLYQLALE
FT                   IAKKATKAFLQDETSEDMHEISCFIRYYQYCEKAGLTDIFDADEMINCLRRKVKSSIGE
FT                   DKEGWKDNYMCKPSQFMITPDSIFYLDNKELSDYEIDFIIETMNSDGTWNITWNWNDYP
FT                   EQWAVSKNWWKATQTLVNMRYLKNFQCL"
     MKMSKKQFEV IRNWMYRNAR PLDIARWKYH FENGNKDDVL AALSAYQNPN GGFGYALEAD        60
     SWNPNSSPIQ TWCATEILYE LGITDKNNEI VRNILSYLDS GKDFQDGHWI AQIPTNDDYP       120
     HAEWWSYREN VIDQWGYNPT ICLVGFILYF ADKQSKLYQL ALEIAKKATK AFLQDETSED       180
     MHEISCFIRY YQYCEKAGLT DIFDADEMIN CLRRKVKSSI GEDKEGWKDN YMCKPSQFMI       240
     TPDSIFYLDN KELSDYEIDF IIETMNSDGT WNITWNWNDY PEQWAVSKNW WKATQTLVNM       300
     RYLKNFQCL                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page