(data stored in ACNUC7421 zone)

EMBL: CP002160.PE18

CP002160.PE18        Location/Qualifiers
FT   CDS             29659..30171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0018"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gur:Gura_0749 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49809"
FT                   /db_xref="GOA:D9SMM4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMM4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL49809.1"
FT                   /translation="MKSSIYNYDEGNISLCPVESYHSEFLFRLFIESRSDLSLISGLDE
FT                   EQKLNIIYQQFIMEQQQLEVMYPKADFNVVMLNNEPIGRFYVYYGERKVRVLEIALLEK
FT                   YRRIGIGSKLLITVIEEAGRLGKNLNLQVAWFNAGAYTFYEKLGFKVIDDSYVYKTMEY
FT                   AKGYNRM"
     MKSSIYNYDE GNISLCPVES YHSEFLFRLF IESRSDLSLI SGLDEEQKLN IIYQQFIMEQ        60
     QQLEVMYPKA DFNVVMLNNE PIGRFYVYYG ERKVRVLEIA LLEKYRRIGI GSKLLITVIE       120
     EAGRLGKNLN LQVAWFNAGA YTFYEKLGFK VIDDSYVYKT MEYAKGYNRM                  170
//

If you have problems or comments...

PBIL Back to PBIL home page