(data stored in ACNUC7421 zone)

EMBL: CP002160.PE180

CP002160.PE180       Location/Qualifiers
FT   CDS             268639..269508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0186"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: dhd:Dhaf_2323 transcriptional regulator, AraC
FT                   family; PFAM: transcription activator effector binding;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; transcription
FT                   activator effector binding"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49971"
FT                   /db_xref="GOA:D9SNV0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV0"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ADL49971.1"
FT                   /translation="MDWVKQLNESINYIEENLAGEISYEAISKIAGCSIYNFQRMFSYI
FT                   ADKPLSEYIRNRRLTMAAFDLLNSTERIIDISLKYGYESQDSFTRAFKNFHGVLPSSVR
FT                   NETVQLKSCPKRSFQITIKGENHMNYQIEQWPAFRVMGISQKMKTSTAFEMVPKVWENA
FT                   WKDGTMNRFIEKFPDYRPAGFLGIAQGGQWGESEEMEYIIAVTNYVDVPSCEHVPALEG
FT                   MKEFAYPEATWAIFEANGELPEAIQKVYKQFYGEWLPNSGYELADLPVIECYMQDNHQE
FT                   VWIAVIKK"
     MDWVKQLNES INYIEENLAG EISYEAISKI AGCSIYNFQR MFSYIADKPL SEYIRNRRLT        60
     MAAFDLLNST ERIIDISLKY GYESQDSFTR AFKNFHGVLP SSVRNETVQL KSCPKRSFQI       120
     TIKGENHMNY QIEQWPAFRV MGISQKMKTS TAFEMVPKVW ENAWKDGTMN RFIEKFPDYR       180
     PAGFLGIAQG GQWGESEEME YIIAVTNYVD VPSCEHVPAL EGMKEFAYPE ATWAIFEANG       240
     ELPEAIQKVY KQFYGEWLPN SGYELADLPV IECYMQDNHQ EVWIAVIKK                   289
//

If you have problems or comments...

PBIL Back to PBIL home page