(data stored in ACNUC7421 zone)

EMBL: CP002160.PE182

CP002160.PE182       Location/Qualifiers
FT   CDS             271740..272393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0189"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   cbe:Cbei_4970 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49973"
FT                   /db_xref="GOA:D9SNV2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV2"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADL49973.1"
FT                   /translation="MKVYAINGSPRKNKNTATLLQKALDGVKEAAKDKEVETEIINLYD
FT                   LNYTGCKSCFACKRIGGTSYGKCAVKDDIHEVLEKISQADGVIFGSPIYFGTITGQLQS
FT                   FLERLLFPYLVYDKNYSTISPKKMPIAFIYTMNVAEDFMDNVGYLSTFNKTESTIGRIF
FT                   TKPSVMYSNNTYQFDDYSKYESSAFSEEEKAAHRKVQFPLDCEKAFEIGKSLIK"
     MKVYAINGSP RKNKNTATLL QKALDGVKEA AKDKEVETEI INLYDLNYTG CKSCFACKRI        60
     GGTSYGKCAV KDDIHEVLEK ISQADGVIFG SPIYFGTITG QLQSFLERLL FPYLVYDKNY       120
     STISPKKMPI AFIYTMNVAE DFMDNVGYLS TFNKTESTIG RIFTKPSVMY SNNTYQFDDY       180
     SKYESSAFSE EEKAAHRKVQ FPLDCEKAFE IGKSLIK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page