(data stored in ACNUC7421 zone)

EMBL: CP002160.PE183

CP002160.PE183       Location/Qualifiers
FT   CDS             272953..273588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0190"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: cbl:CLK_0307
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49974"
FT                   /db_xref="GOA:D9SNV3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADL49974.1"
FT                   /translation="MTEFWEKSFIEKQTMWGFNPSESAVIAKDLFIENNIKDILIPGIG
FT                   YGRNAKVFIDNGINVTGIEISKTAIDLAKQHGININIYHGSVGDMPFEDKLYEGIFSYA
FT                   LIHLLNERERKKFISDCYEQLKQGGYMIFTAVSKKAPMFGKGQKLDENYYETMPGVRIF
FT                   FYDSESIKKDFEEYGLVEFSEIDEIDSDNKDKPPMKFLLIKCKRTKSR"
     MTEFWEKSFI EKQTMWGFNP SESAVIAKDL FIENNIKDIL IPGIGYGRNA KVFIDNGINV        60
     TGIEISKTAI DLAKQHGINI NIYHGSVGDM PFEDKLYEGI FSYALIHLLN ERERKKFISD       120
     CYEQLKQGGY MIFTAVSKKA PMFGKGQKLD ENYYETMPGV RIFFYDSESI KKDFEEYGLV       180
     EFSEIDEIDS DNKDKPPMKF LLIKCKRTKS R                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page