(data stored in ACNUC7421 zone)

EMBL: CP002160.PE185

CP002160.PE185       Location/Qualifiers
FT   CDS             274820..275998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0192"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   cbe:Cbei_3630 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49976"
FT                   /db_xref="GOA:D9SNV5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV5"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADL49976.1"
FT                   /translation="MRDVVIVSAVRTAIGAYGKTLKDVPAVDLGAIVIKEAVKRANIKP
FT                   EEINEVIFGNVLQAGLGQNPARQAAVKAGLPVEIPAFTINKVCGSGLRSISLAAQIIKA
FT                   GDADTIVVGGMENMSSAPFLLDSARWGQRMGHGELVDEMIKDGLWDAFNDYHMGITAEN
FT                   VAEKWNITREEQDEFSLLSQQKAEAAIKNGEFKDEIVPVVIKTKKGEVIFDQDEFPRFG
FT                   NTIEALKKLKPIFKKDGTVTAGNASGLNDGAAALVIMSADKAKALGIKPLAKITSYGSA
FT                   GLDPAIMGYGAFHATKAALDKVNLKAEDLDLIEANEAYASQSIAITKDLNLDMSKVNVN
FT                   GGAIALGHPIGASGARILVTLLHAMEKRDAKRGLATLCIGGGQGTALIVERE"
     MRDVVIVSAV RTAIGAYGKT LKDVPAVDLG AIVIKEAVKR ANIKPEEINE VIFGNVLQAG        60
     LGQNPARQAA VKAGLPVEIP AFTINKVCGS GLRSISLAAQ IIKAGDADTI VVGGMENMSS       120
     APFLLDSARW GQRMGHGELV DEMIKDGLWD AFNDYHMGIT AENVAEKWNI TREEQDEFSL       180
     LSQQKAEAAI KNGEFKDEIV PVVIKTKKGE VIFDQDEFPR FGNTIEALKK LKPIFKKDGT       240
     VTAGNASGLN DGAAALVIMS ADKAKALGIK PLAKITSYGS AGLDPAIMGY GAFHATKAAL       300
     DKVNLKAEDL DLIEANEAYA SQSIAITKDL NLDMSKVNVN GGAIALGHPI GASGARILVT       360
     LLHAMEKRDA KRGLATLCIG GGQGTALIVE RE                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page