(data stored in ACNUC7421 zone)

EMBL: CP002160.PE188

CP002160.PE188       Location/Qualifiers
FT   CDS             280543..281157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_2164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49979"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNV8"
FT                   /inference="similar to AA sequence:KEGG:Cphy_2164"
FT                   /protein_id="ADL49979.1"
FT                   /translation="MEDIKIGSLLSFGNYNWRVLDIQNNRALIITEEVIEERPYHNAYK
FT                   DITWADCALRKYLNGEFYEKFNETDKARIIPVTNKNLDNQWYGSKGGVDTKDSIFLLSL
FT                   EEVCTYFGDSLSKLHNPGKNQRYWFERKDKNNSKRIARLQGQEWGWWWWLRSPGRVNVK
FT                   AVYIFGTDGNIGIQGNNILKGNIDEGRCRGGVRPALWLKLE"
     MEDIKIGSLL SFGNYNWRVL DIQNNRALII TEEVIEERPY HNAYKDITWA DCALRKYLNG        60
     EFYEKFNETD KARIIPVTNK NLDNQWYGSK GGVDTKDSIF LLSLEEVCTY FGDSLSKLHN       120
     PGKNQRYWFE RKDKNNSKRI ARLQGQEWGW WWWLRSPGRV NVKAVYIFGT DGNIGIQGNN       180
     ILKGNIDEGR CRGGVRPALW LKLE                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page