(data stored in ACNUC7421 zone)

EMBL: CP002160.PE196

CP002160.PE196       Location/Qualifiers
FT   CDS             complement(287535..288218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0203"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: cbl:CLK_0304
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   Glycosyl transferase, family 4, conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49987"
FT                   /db_xref="GOA:D9SNW6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW6"
FT                   /inference="protein motif:PRIAM:2.7.8.13"
FT                   /protein_id="ADL49987.1"
FT                   /translation="MINIVYAILLSFLLSSLIGTILVPIFKKLKLGQNIREEGPKSHYK
FT                   KAATPTFGGIIFILSSIIAMLFFIKQYNEEIQFIFYSLIAFGFIGFLDDFLKKVHKKNQ
FT                   GLTSKQKMILLLFASTTFAIYAYYNPEIGSTIILPFAGKMIDLKLLYIPFIIFIYVATT
FT                   NSVNLTDGLDGLATLVTLLVMVFFALVAFNFRYYTLAIFCGCMCGALLGFLRFNSFPAK
FT                   IIIIF"
     MINIVYAILL SFLLSSLIGT ILVPIFKKLK LGQNIREEGP KSHYKKAATP TFGGIIFILS        60
     SIIAMLFFIK QYNEEIQFIF YSLIAFGFIG FLDDFLKKVH KKNQGLTSKQ KMILLLFAST       120
     TFAIYAYYNP EIGSTIILPF AGKMIDLKLL YIPFIIFIYV ATTNSVNLTD GLDGLATLVT       180
     LLVMVFFALV AFNFRYYTLA IFCGCMCGAL LGFLRFNSFP AKIIIIF                     227
//

If you have problems or comments...

PBIL Back to PBIL home page