(data stored in ACNUC7421 zone)

EMBL: CP002160.PE198

CP002160.PE198       Location/Qualifiers
FT   CDS             289533..289796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0205"
FT                   /product="helix-turn-helix domain of resolvase"
FT                   /note="KEGG: bmq:BMQ_1971 helix-turn-helix domain of
FT                   resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49989"
FT                   /db_xref="GOA:D9SNW8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNW8"
FT                   /inference="similar to AA sequence:KEGG:BMQ_1971"
FT                   /protein_id="ADL49989.1"
FT                   /translation="MKYINATEVLPLDLLSEIQKYIAGEVLYIPQPKGLKNSWGSRSGA
FT                   RQEIINRNKQIKSEKEDGRSIEELMMKYNLSYDTIKKIVYLK"
     MKYINATEVL PLDLLSEIQK YIAGEVLYIP QPKGLKNSWG SRSGARQEII NRNKQIKSEK        60
     EDGRSIEELM MKYNLSYDTI KKIVYLK                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page