(data stored in ACNUC7421 zone)

EMBL: CP002160.PE2

CP002160.PE2         Location/Qualifiers
FT   CDS             1715..2818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: cno:NT01CX_0866 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49793"
FT                   /db_xref="GOA:D9SMK8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMK8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADL49793.1"
FT                   /translation="MNFTCDKTNLQEAISIAQKAVTGKSTMPILQGLLLNARGNKLTIN
FT                   SSDIDLGIETKCNANIKEEGSIVVDSKLFGDIIRKLPNSEIQIKSISEGTIEITCQRSR
FT                   FTLVHMKADEFPQLPYIDEDEIISIPQKLIKNMIRSTIFAIAIDETRPILTGILFEIKN
FT                   RTLNLVALDGFRLALKKETIDTEQEFSAVIPGKTLHEVVKILEDEGDVDITFTTNHILF
FT                   NLGETKVVSRLLEGEFIKYQAIIPEEHELSISVNRASLLNSIERASLVSKDASSNLIKF
FT                   NISEDNIVITSNSQLGDVREEVSIKLLKGNELQIAFNSKYLIDALKIMEEETITLQFTS
FT                   AVSPCIIKNIENDNVIYLVLPVRISNS"
     MNFTCDKTNL QEAISIAQKA VTGKSTMPIL QGLLLNARGN KLTINSSDID LGIETKCNAN        60
     IKEEGSIVVD SKLFGDIIRK LPNSEIQIKS ISEGTIEITC QRSRFTLVHM KADEFPQLPY       120
     IDEDEIISIP QKLIKNMIRS TIFAIAIDET RPILTGILFE IKNRTLNLVA LDGFRLALKK       180
     ETIDTEQEFS AVIPGKTLHE VVKILEDEGD VDITFTTNHI LFNLGETKVV SRLLEGEFIK       240
     YQAIIPEEHE LSISVNRASL LNSIERASLV SKDASSNLIK FNISEDNIVI TSNSQLGDVR       300
     EEVSIKLLKG NELQIAFNSK YLIDALKIME EETITLQFTS AVSPCIIKNI ENDNVIYLVL       360
     PVRISNS                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page