(data stored in ACNUC7421 zone)

EMBL: CP002160.PE201

CP002160.PE201       Location/Qualifiers
FT   CDS             290759..291622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0208"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: cbl:CLK_1587
FT                   carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49992"
FT                   /db_xref="GOA:D9SNX1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9SNX1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADL49992.1"
FT                   /translation="MSIYKSQDGKIASIKLYDAQLQKLGYLFSDKYVTTSFGKIHLIET
FT                   GNMKGKPLLVFHGGNSTTAYNLLMYKFLLKDFHVYAIDTIGHPGKSDEVCLSSNNYDYG
FT                   KWASEVITAIGYDKISCFGVSFGGGILAKLMCIAPEKIEKAVLVVPAGINNALPISSVK
FT                   MLIPLIKYVVTKKEKYLKETALYMALSEIVLDEDTLDTIKDSFDNVKTKVGMPSNIMRK
FT                   LLRNYKTPTLVMAAEKDCLFPAKRVLSRAKTIIPNCKVHMLKGCGHMHIMPQYEKKMIV
FT                   DFLIDS"
     MSIYKSQDGK IASIKLYDAQ LQKLGYLFSD KYVTTSFGKI HLIETGNMKG KPLLVFHGGN        60
     STTAYNLLMY KFLLKDFHVY AIDTIGHPGK SDEVCLSSNN YDYGKWASEV ITAIGYDKIS       120
     CFGVSFGGGI LAKLMCIAPE KIEKAVLVVP AGINNALPIS SVKMLIPLIK YVVTKKEKYL       180
     KETALYMALS EIVLDEDTLD TIKDSFDNVK TKVGMPSNIM RKLLRNYKTP TLVMAAEKDC       240
     LFPAKRVLSR AKTIIPNCKV HMLKGCGHMH IMPQYEKKMI VDFLIDS                     287
//

If you have problems or comments...

PBIL Back to PBIL home page