(data stored in ACNUC7421 zone)

EMBL: CP002160.PE203

CP002160.PE203       Location/Qualifiers
FT   CDS             293508..294368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0210"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: cbf:CLI_0865 AraC family transcriptional
FT                   regulator; PFAM: transcription activator effector binding;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: transcription activator effector binding;
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49994"
FT                   /db_xref="GOA:D9SPE5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPE5"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ADL49994.1"
FT                   /translation="MEWIEGIGEAIRYIEDNITEEILIENIAKKVLMSPFYFQKGFAML
FT                   CGFTVGEYIRQRRLTLAGREIVSTDEKIIDIALKYGYTSPDSFTKAFTRFHGVTPTAVR
FT                   KDGAMIKSLAPLKIKFSLEGGYIMDYKIVEKDSFTIMGVSKVFKYDSATTEIPQFWAEH
FT                   YQTGKGKFVCGMYGINIDESMGSEEFEYLIADNYNPSVEVPDGFVTKIIPKYTWAVFAS
FT                   KGPMPKSLQDVSGRIFSEWLPNCKDYEIAAGYNIEMYTNTDDYPQGSQDESYYSEIWIP
FT                   VRRKD"
     MEWIEGIGEA IRYIEDNITE EILIENIAKK VLMSPFYFQK GFAMLCGFTV GEYIRQRRLT        60
     LAGREIVSTD EKIIDIALKY GYTSPDSFTK AFTRFHGVTP TAVRKDGAMI KSLAPLKIKF       120
     SLEGGYIMDY KIVEKDSFTI MGVSKVFKYD SATTEIPQFW AEHYQTGKGK FVCGMYGINI       180
     DESMGSEEFE YLIADNYNPS VEVPDGFVTK IIPKYTWAVF ASKGPMPKSL QDVSGRIFSE       240
     WLPNCKDYEI AAGYNIEMYT NTDDYPQGSQ DESYYSEIWI PVRRKD                      286
//

If you have problems or comments...

PBIL Back to PBIL home page