(data stored in ACNUC7421 zone)

EMBL: CP002160.PE206

CP002160.PE206       Location/Qualifiers
FT   CDS             299569..300906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0213"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: cth:Cthe_1957 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49997"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPE8"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL49997.1"
FT                   /translation="MGKRSVVLIAILIFISLTVDFGKYRLSTNNQFTQTDVKDESKDDE
FT                   KSDSSNEPINLTILSYYKDFENQANEYHKAHPNVNIKIDVVDYDHIIETAFKSIASGSS
FT                   PDIIVFDSNHTFNLNGNEALQNLLEEPFSAGKYKQGFAEDLWRSVLSYDKNRLIGIPLV
FT                   INDMVTLYRADIMEQYGFPSEPEALAQYMKNPENWLKIAETLKLDNKYIASWATDPLNI
FT                   YGSGTGIFDENLNLLRLDSNFEKAIELSQNIKMNGLSLNGDIYSEDGKQALKDGRLAMV
FT                   YGGSWLIYNFKDLVPEERGKWRVAKLPFGINGFGSSNIMAISSTSKYKEEAWDFIKTFE
FT                   LDDKKSYWGGSIPVYLPAVNNIKNFSNKDAFFGDQDLGLFFKDIRQSTKVPVFTPLDDM
FT                   AMSIWKDKTQYAIANAVNPKDALKQYEEEINSRLADKKKILLDRKQ"
     MGKRSVVLIA ILIFISLTVD FGKYRLSTNN QFTQTDVKDE SKDDEKSDSS NEPINLTILS        60
     YYKDFENQAN EYHKAHPNVN IKIDVVDYDH IIETAFKSIA SGSSPDIIVF DSNHTFNLNG       120
     NEALQNLLEE PFSAGKYKQG FAEDLWRSVL SYDKNRLIGI PLVINDMVTL YRADIMEQYG       180
     FPSEPEALAQ YMKNPENWLK IAETLKLDNK YIASWATDPL NIYGSGTGIF DENLNLLRLD       240
     SNFEKAIELS QNIKMNGLSL NGDIYSEDGK QALKDGRLAM VYGGSWLIYN FKDLVPEERG       300
     KWRVAKLPFG INGFGSSNIM AISSTSKYKE EAWDFIKTFE LDDKKSYWGG SIPVYLPAVN       360
     NIKNFSNKDA FFGDQDLGLF FKDIRQSTKV PVFTPLDDMA MSIWKDKTQY AIANAVNPKD       420
     ALKQYEEEIN SRLADKKKIL LDRKQ                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page