(data stored in ACNUC7421 zone)

EMBL: CP002160.PE207

CP002160.PE207       Location/Qualifiers
FT   CDS             complement(301262..301804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0214"
FT                   /product="Protein of unknown function DUF2947"
FT                   /note="PFAM: Protein of unknown function DUF2947; KEGG:
FT                   lmh:LMHCC_2381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49998"
FT                   /db_xref="InterPro:IPR021334"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPE9"
FT                   /inference="protein motif:PFAM:PF11163"
FT                   /protein_id="ADL49998.1"
FT                   /translation="MVDSPNDSSKYISMESFGINWFFYVEDMEIPEEDIKNIKPLSKDY
FT                   STFIWNMNINNRKHHFALLSKDEKLSLSLTEMDYHWQQDWNNGTYENLSNYLSENIICK
FT                   PSDKVIVFWQKEHSVETSWDIFLRHWANFLFDDEGVILVSRTYENILLFTSDGMIQMGK
FT                   RLWSNSYILDKQEKIMK"
     MVDSPNDSSK YISMESFGIN WFFYVEDMEI PEEDIKNIKP LSKDYSTFIW NMNINNRKHH        60
     FALLSKDEKL SLSLTEMDYH WQQDWNNGTY ENLSNYLSEN IICKPSDKVI VFWQKEHSVE       120
     TSWDIFLRHW ANFLFDDEGV ILVSRTYENI LLFTSDGMIQ MGKRLWSNSY ILDKQEKIMK       180
//

If you have problems or comments...

PBIL Back to PBIL home page