(data stored in ACNUC7421 zone)

EMBL: CP002160.PE208

CP002160.PE208       Location/Qualifiers
FT   CDS             complement(301906..302298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bre:BRE_1001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49999"
FT                   /db_xref="GOA:D9SPF0"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF0"
FT                   /inference="similar to AA sequence:KEGG:BRE_1001"
FT                   /protein_id="ADL49999.1"
FT                   /translation="MKRTIAIIFFTLINLVELLILGFLAAIYSYFLDIFPWKETDPIAL
FT                   LVLFPLSIVFLVIGILLCLFKIKLSILKTNILTPFCTIAYLMLSLFFIPKYPNFFYITD
FT                   SLVIVVSFILVLITTIISIKKIRVLK"
     MKRTIAIIFF TLINLVELLI LGFLAAIYSY FLDIFPWKET DPIALLVLFP LSIVFLVIGI        60
     LLCLFKIKLS ILKTNILTPF CTIAYLMLSL FFIPKYPNFF YITDSLVIVV SFILVLITTI       120
     ISIKKIRVLK                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page