(data stored in ACNUC7421 zone)

EMBL: CP002160.PE209

CP002160.PE209       Location/Qualifiers
FT   CDS             302785..303222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50000"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF1"
FT                   /inference="similar to AA sequence:KEGG:CLK_1328"
FT                   /protein_id="ADL50000.1"
FT                   /translation="MIIKAIKDYISTCSYLQEFEAAICAVVGSGTSNSELYAIEVVKAE
FT                   PILKKYMNGDSLRQCHFTFCSKESYGIDVLRSIESSSFYDDFENWIEEENRKGNLPSLT
FT                   GNYIPVEIKVISSGYAFPVSQDKSRYQIELILNYYKKQGGN"
     MIIKAIKDYI STCSYLQEFE AAICAVVGSG TSNSELYAIE VVKAEPILKK YMNGDSLRQC        60
     HFTFCSKESY GIDVLRSIES SSFYDDFENW IEEENRKGNL PSLTGNYIPV EIKVISSGYA       120
     FPVSQDKSRY QIELILNYYK KQGGN                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page