(data stored in ACNUC7421 zone)

EMBL: CP002160.PE211

CP002160.PE211       Location/Qualifiers
FT   CDS             303910..304251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0218"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50002"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF3"
FT                   /inference="similar to AA sequence:KEGG:CLK_1326"
FT                   /protein_id="ADL50002.1"
FT                   /translation="MIINNVELIDIDIFDVEVAEKYENALKEVETVASKVKDMKLSESV
FT                   RTQCESIFKVFNILFGEGADKKIFGDKMNLLTCIKAFEELVVQVNDQKSAIEEIASKYS
FT                   PNRAQRRKK"
     MIINNVELID IDIFDVEVAE KYENALKEVE TVASKVKDMK LSESVRTQCE SIFKVFNILF        60
     GEGADKKIFG DKMNLLTCIK AFEELVVQVN DQKSAIEEIA SKYSPNRAQR RKK              113
//

If you have problems or comments...

PBIL Back to PBIL home page