(data stored in ACNUC7421 zone)

EMBL: CP002160.PE212

CP002160.PE212       Location/Qualifiers
FT   CDS             304251..304862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0219"
FT                   /product="putative protein GP15"
FT                   /note="KEGG: cbl:CLK_1325 putative protein GP15"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50003"
FT                   /db_xref="InterPro:IPR009660"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF4"
FT                   /inference="similar to AA sequence:KEGG:CLK_1325"
FT                   /protein_id="ADL50003.1"
FT                   /translation="MNLLIDLLPNTVDINGVKYEINSDFRTSILFEIMMQDTSLSDEDK
FT                   IIQALQLYYPRVPEDIDTAIDKMLWLYRCGKDETSLKGTGSNKTNQIYSYEYDEDYIYS
FT                   AFLDQYGVDLQDIEFLHWWKFKAMFKSLKEDNEIVKIMGYRAMDLSKIKDKSQRDFYKK
FT                   AKEIYKIPTMLNKDEKQKISDIEETLMGSGDLASVLKQDK"
     MNLLIDLLPN TVDINGVKYE INSDFRTSIL FEIMMQDTSL SDEDKIIQAL QLYYPRVPED        60
     IDTAIDKMLW LYRCGKDETS LKGTGSNKTN QIYSYEYDED YIYSAFLDQY GVDLQDIEFL       120
     HWWKFKAMFK SLKEDNEIVK IMGYRAMDLS KIKDKSQRDF YKKAKEIYKI PTMLNKDEKQ       180
     KISDIEETLM GSGDLASVLK QDK                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page