(data stored in ACNUC7421 zone)

EMBL: CP002160.PE215

CP002160.PE215       Location/Qualifiers
FT   CDS             306828..307535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0222"
FT                   /product="phage tail component"
FT                   /note="TIGRFAM: phage tail component; KEGG: cac:CAC0062
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50006"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="InterPro:IPR038675"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPF7"
FT                   /inference="protein motif:TFAM:TIGR01633"
FT                   /protein_id="ADL50006.1"
FT                   /translation="MLKNGEIYFNGNTSIGLNLFLEEYPSVPIANEDFEEITVEGRSGS
FT                   LYINKGTYPDKKIPFNFTILSPQIEIDFDKVYQWLTEIQDKRLIFGREDRCYIVKKVLF
FT                   ENLQKQFKTIGQFKVTFICEPFSSDLNYTTYEITSDNYSFYYQGNAPAESLIKVYGIGN
FT                   IQLTINGETMVIYDVTDYVEIDSKFMQVRNKDKTSKDSAAYGVFPLFSAGANTIKYTGN
FT                   VTKIIVEYTTRYK"
     MLKNGEIYFN GNTSIGLNLF LEEYPSVPIA NEDFEEITVE GRSGSLYINK GTYPDKKIPF        60
     NFTILSPQIE IDFDKVYQWL TEIQDKRLIF GREDRCYIVK KVLFENLQKQ FKTIGQFKVT       120
     FICEPFSSDL NYTTYEITSD NYSFYYQGNA PAESLIKVYG IGNIQLTING ETMVIYDVTD       180
     YVEIDSKFMQ VRNKDKTSKD SAAYGVFPLF SAGANTIKYT GNVTKIIVEY TTRYK            235
//

If you have problems or comments...

PBIL Back to PBIL home page