(data stored in ACNUC7421 zone)

EMBL: CP002160.PE228

CP002160.PE228       Location/Qualifiers
FT   CDS             complement(323823..325235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:CTC01789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50019"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH0"
FT                   /inference="similar to AA sequence:KEGG:CTC01789"
FT                   /protein_id="ADL50019.1"
FT                   /translation="MSTNIPEDLMNNVEKNLRKHIKDKKRKKHIYKAAAAIISLFIILP
FT                   GSALAVAKYNNSILYSQEIDLARENKNITEVNETFKYKDVEFRIKEIVADATGMEVIYD
FT                   VSDPRYSIDEITFGDKDGTQFTEWGFSLPDPYCDNKEKAFLITLSNAAVDYMRDNPITI
FT                   KINTLTFNDDQNSNKLFDKVTSLINPKDDLKVDWNLKMQIPMQPIKTLSINKEYALDIG
FT                   TLKINSLQVGVLKSVFDYNFIPKDKSITDIFPTFSIRLDNDYNIANVSHSYGLNLGETS
FT                   SNTVGEYTVFGSEDNKGIHGTQEFNSIYYKEVSEIGIRLLNLSVTYDFGNSNIYKIDKN
FT                   NLPLTFNFNGEEFKLTAIEEKENATEYSLEFNKTNRIFTQLRFKFSDTYNYQSSSDSDD
FT                   IQFADQSSRDKLHNILVEKIPNLPAIEDRFKIFNTGVIRSRETIPTRASEFIITEGTKS
FT                   FLYDEEEIIWHK"
     MSTNIPEDLM NNVEKNLRKH IKDKKRKKHI YKAAAAIISL FIILPGSALA VAKYNNSILY        60
     SQEIDLAREN KNITEVNETF KYKDVEFRIK EIVADATGME VIYDVSDPRY SIDEITFGDK       120
     DGTQFTEWGF SLPDPYCDNK EKAFLITLSN AAVDYMRDNP ITIKINTLTF NDDQNSNKLF       180
     DKVTSLINPK DDLKVDWNLK MQIPMQPIKT LSINKEYALD IGTLKINSLQ VGVLKSVFDY       240
     NFIPKDKSIT DIFPTFSIRL DNDYNIANVS HSYGLNLGET SSNTVGEYTV FGSEDNKGIH       300
     GTQEFNSIYY KEVSEIGIRL LNLSVTYDFG NSNIYKIDKN NLPLTFNFNG EEFKLTAIEE       360
     KENATEYSLE FNKTNRIFTQ LRFKFSDTYN YQSSSDSDDI QFADQSSRDK LHNILVEKIP       420
     NLPAIEDRFK IFNTGVIRSR ETIPTRASEF IITEGTKSFL YDEEEIIWHK                  470
//

If you have problems or comments...

PBIL Back to PBIL home page