(data stored in ACNUC7421 zone)

EMBL: CP002160.PE234

CP002160.PE234       Location/Qualifiers
FT   CDS             complement(329800..330150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tad:TRIADDRAFT_62504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50025"
FT                   /db_xref="GOA:D9SPH6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPH6"
FT                   /inference="similar to AA sequence:KEGG:TRIADDRAFT_62504"
FT                   /protein_id="ADL50025.1"
FT                   /translation="MDETAVINALNILGNKFDSLSQIMELDIAQKEAINFNELIIAQLA
FT                   LLASLLMLIGDMLILLSQLKQNEQTLKEEKKLEEYDFAETLSMWVYVLGDYLCLESSLL
FT                   ELKDLKQSSQDE"
     MDETAVINAL NILGNKFDSL SQIMELDIAQ KEAINFNELI IAQLALLASL LMLIGDMLIL        60
     LSQLKQNEQT LKEEKKLEEY DFAETLSMWV YVLGDYLCLE SSLLELKDLK QSSQDE           116
//

If you have problems or comments...

PBIL Back to PBIL home page