(data stored in ACNUC7421 zone)

EMBL: CP002160.PE247

CP002160.PE247       Location/Qualifiers
FT   CDS             340694..341437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0254"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine-protein kinase-like domain;
FT                   KEGG: ckr:CKR_0539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50038"
FT                   /db_xref="GOA:D9SPI9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPI9"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADL50038.1"
FT                   /translation="MVMIDFFKKKIYPPGFLLGGYKILSTIGEGRFGICYLAELDDKQY
FT                   VLKVIKPNAIKKSGNKLIFEERILSSIDNPAIPKILEVIKTDEIHVYVLEYKKGRTLEE
FT                   MIFDDGHVFSRCEIYKVGIALINIIKYLHERNIVHRDIRVPNVVIDEDEVYLIDFGLAR
FT                   LVDNDRYIPNIDFRCLGHLLIHLYYSSFDGTNKKSGPWYEELELSQKELIFLKKLLGLK
FT                   RKYMSIDDVEHDFEKIFPREDIVSK"
     MVMIDFFKKK IYPPGFLLGG YKILSTIGEG RFGICYLAEL DDKQYVLKVI KPNAIKKSGN        60
     KLIFEERILS SIDNPAIPKI LEVIKTDEIH VYVLEYKKGR TLEEMIFDDG HVFSRCEIYK       120
     VGIALINIIK YLHERNIVHR DIRVPNVVID EDEVYLIDFG LARLVDNDRY IPNIDFRCLG       180
     HLLIHLYYSS FDGTNKKSGP WYEELELSQK ELIFLKKLLG LKRKYMSIDD VEHDFEKIFP       240
     REDIVSK                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page