(data stored in ACNUC7421 zone)

EMBL: CP002160.PE257

CP002160.PE257       Location/Qualifiers
FT   CDS             complement(348699..349301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0266"
FT                   /product="galactoside O-acetyltransferase"
FT                   /note="manually curated; KEGG: pjd:Pjdr2_4506 galactoside
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50048"
FT                   /db_xref="GOA:D9SPJ9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPJ9"
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_4506"
FT                   /protein_id="ADL50048.1"
FT                   /translation="MRTIETYEKMHSGKIYDCTNEELMNLQTKCLDRLYDFNATRPTEY
FT                   EKRIKMLKEMFAEFGDGCYIEPPLHSNWGGKHVHFGNNVYANFNLTLVDDTHIYVGDYT
FT                   MFGPNVIVATAAHPITPEMRMPVTQFNKSVYIGKNCWLGAGTIVLPGVTIGDNTVIGAG
FT                   SVVTKDIPANVVAVGNPCRVLRAINDDDWKHGQELLK"
     MRTIETYEKM HSGKIYDCTN EELMNLQTKC LDRLYDFNAT RPTEYEKRIK MLKEMFAEFG        60
     DGCYIEPPLH SNWGGKHVHF GNNVYANFNL TLVDDTHIYV GDYTMFGPNV IVATAAHPIT       120
     PEMRMPVTQF NKSVYIGKNC WLGAGTIVLP GVTIGDNTVI GAGSVVTKDI PANVVAVGNP       180
     CRVLRAINDD DWKHGQELLK                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page