(data stored in ACNUC7421 zone)

EMBL: CP002160.PE258

CP002160.PE258       Location/Qualifiers
FT   CDS             complement(349382..349885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0267"
FT                   /product="acetyltransferase"
FT                   /note="KEGG: cpy:Cphy_2576 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50049"
FT                   /db_xref="GOA:D9SPK0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPK0"
FT                   /inference="similar to AA sequence:KEGG:Cphy_2576"
FT                   /protein_id="ADL50049.1"
FT                   /translation="MTIELKKVNIEDKEILRNLLEKYDYEFSQWDNRDVNKLGLYGYNY
FT                   LDCYWTEEKRWAFFIVVDGNLAGFVMINDYPEVDEVTDYSLAEFFVMYKYRRSGVGRFA
FT                   AMKVFDMFHGKWQLKRHPKNIASVHFWNKVVSEYTKSNYKLIESYPNSVYNDGTLGDII
FT                   LFTS"
     MTIELKKVNI EDKEILRNLL EKYDYEFSQW DNRDVNKLGL YGYNYLDCYW TEEKRWAFFI        60
     VVDGNLAGFV MINDYPEVDE VTDYSLAEFF VMYKYRRSGV GRFAAMKVFD MFHGKWQLKR       120
     HPKNIASVHF WNKVVSEYTK SNYKLIESYP NSVYNDGTLG DIILFTS                     167
//

If you have problems or comments...

PBIL Back to PBIL home page