(data stored in ACNUC7421 zone)

EMBL: CP002160.PE26

CP002160.PE26        Location/Qualifiers
FT   CDS             53384..55000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0028"
FT                   /product="Na/Pi-cotransporter II-related protein"
FT                   /note="KEGG: cbk:CLL_A0275 Na/Pi-cotransporter family
FT                   protein/PhoU family protein; TIGRFAM: Na/Pi-cotransporter
FT                   II-related protein; PFAM: Na+/Picotransporter; PhoU family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49817"
FT                   /db_xref="GOA:D9SMN2"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN2"
FT                   /inference="protein motif:TFAM:TIGR00704"
FT                   /protein_id="ADL49817.1"
FT                   /translation="MDIEKLIIQLIGGVGLFLYGMRLMGDGLENSAGDRLKDILEKVTK
FT                   RPIIAVGVGAIITAIIQSSSATIIMVVGFVNVGLISLMQATWIIMGANIGTTITTQLFT
FT                   FRLEYIAPILVGIGAIAVLFTKGRKRRGIEHVVLGFGMLFMGMGLMTNALRPIAHTSEF
FT                   NNIILAVGDKWIIGIFIGFCLTAVVQSSAATTGILIALAGTDQISINIAIPILFGCNIG
FT                   TCVTTLISSIGTSKKARKAAFIHLIYNVMGTIIFIPLMGTLAKIVVNINPDNVGRQIAN
FT                   AHLIFNIVNTVILLPLTKYLIMIVEKLIPGEDELKIIGPKFIDDRLLETPVIAAGQVIK
FT                   ETIRMANTARMNLEIAMEAFINKDEKLVKSVYENEKIINNLEEEITRFLVLLSKCDLSD
FT                   KESAIVSSTFHIVNDIERIGDHAENIVELASKRILKNIQYSEESLGELKNIYNYTLTAL
FT                   KVAIESYAIGDFRKAESVNDLEVRIDESFRIYSKNHIRRLNNDRCTAYAGVVFMDLLSN
FT                   FERIGDHSVNIAGIVIENASV"
     MDIEKLIIQL IGGVGLFLYG MRLMGDGLEN SAGDRLKDIL EKVTKRPIIA VGVGAIITAI        60
     IQSSSATIIM VVGFVNVGLI SLMQATWIIM GANIGTTITT QLFTFRLEYI APILVGIGAI       120
     AVLFTKGRKR RGIEHVVLGF GMLFMGMGLM TNALRPIAHT SEFNNIILAV GDKWIIGIFI       180
     GFCLTAVVQS SAATTGILIA LAGTDQISIN IAIPILFGCN IGTCVTTLIS SIGTSKKARK       240
     AAFIHLIYNV MGTIIFIPLM GTLAKIVVNI NPDNVGRQIA NAHLIFNIVN TVILLPLTKY       300
     LIMIVEKLIP GEDELKIIGP KFIDDRLLET PVIAAGQVIK ETIRMANTAR MNLEIAMEAF       360
     INKDEKLVKS VYENEKIINN LEEEITRFLV LLSKCDLSDK ESAIVSSTFH IVNDIERIGD       420
     HAENIVELAS KRILKNIQYS EESLGELKNI YNYTLTALKV AIESYAIGDF RKAESVNDLE       480
     VRIDESFRIY SKNHIRRLNN DRCTAYAGVV FMDLLSNFER IGDHSVNIAG IVIENASV         538
//

If you have problems or comments...

PBIL Back to PBIL home page