(data stored in ACNUC7421 zone)

EMBL: CP002160.PE264

CP002160.PE264       Location/Qualifiers
FT   CDS             complement(361231..361710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abu:Abu_0624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50055"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPK6"
FT                   /inference="similar to AA sequence:KEGG:Abu_0624"
FT                   /protein_id="ADL50055.1"
FT                   /translation="MKKRLILLSALIIVIMSTALILSRPKGLTSKESLVKRVMEIQLTI
FT                   GEVTDNEASELRKNIILTSEKLDPSCIPGLEALGITILSPSEIEQKTKEEGNFKFLVFN
FT                   DITIDEKEAIITLNTIYTRQEDKKIVYKDFSGLTIRFHKYFGRWFEDPSREIYCI"
     MKKRLILLSA LIIVIMSTAL ILSRPKGLTS KESLVKRVME IQLTIGEVTD NEASELRKNI        60
     ILTSEKLDPS CIPGLEALGI TILSPSEIEQ KTKEEGNFKF LVFNDITIDE KEAIITLNTI       120
     YTRQEDKKIV YKDFSGLTIR FHKYFGRWFE DPSREIYCI                              159
//

If you have problems or comments...

PBIL Back to PBIL home page