(data stored in ACNUC7421 zone)

EMBL: CP002160.PE268

CP002160.PE268       Location/Qualifiers
FT   CDS             complement(364632..364814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0277"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_1998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50059"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL0"
FT                   /inference="similar to AA sequence:KEGG:Clos_1998"
FT                   /protein_id="ADL50059.1"
FT                   /translation="MGYVKAETILPNNLIKELQKYIQGEYVYIPAQSDTRKKWGEKSGN
FT                   RTYIQIGIKILSENI"
     MGYVKAETIL PNNLIKELQK YIQGEYVYIP AQSDTRKKWG EKSGNRTYIQ IGIKILSENI        60
//

If you have problems or comments...

PBIL Back to PBIL home page