(data stored in ACNUC7421 zone)

EMBL: CP002160.PE270

CP002160.PE270       Location/Qualifiers
FT   CDS             366350..366880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_2708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50061"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL2"
FT                   /inference="similar to AA sequence:KEGG:BcerKBAB4_2708"
FT                   /protein_id="ADL50061.1"
FT                   /translation="MLKRCIMIFPKFENGQVIDKIREKYDPLVTHVRPHITLVFPFDSN
FT                   IKTNELKNHISLVLSEVETFEVILKGITPVSSFGKYLFLNIEKGTEEIIQLHKKLYTGI
FT                   LEEHFPEWLKGNNFLPHMTVGSFQKEEEFQMAAEETKAVVDAFRTIVTAVSVEIIDENE
FT                   DSIIELEIPLKAI"
     MLKRCIMIFP KFENGQVIDK IREKYDPLVT HVRPHITLVF PFDSNIKTNE LKNHISLVLS        60
     EVETFEVILK GITPVSSFGK YLFLNIEKGT EEIIQLHKKL YTGILEEHFP EWLKGNNFLP       120
     HMTVGSFQKE EEFQMAAEET KAVVDAFRTI VTAVSVEIID ENEDSIIELE IPLKAI           176
//

If you have problems or comments...

PBIL Back to PBIL home page