(data stored in ACNUC7421 zone)

EMBL: CP002160.PE274

CP002160.PE274       Location/Qualifiers
FT   CDS             complement(369517..370395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckr:CKR_2294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50065"
FT                   /db_xref="GOA:D9SPL6"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPL6"
FT                   /inference="similar to AA sequence:KEGG:CKR_2294"
FT                   /protein_id="ADL50065.1"
FT                   /translation="MERKLKRIDMLITCIIILLIIITLVGACSFQIDKSYMVTNQYGDA
FT                   VKIFGSGIYAHDSYFKAPIFIGTDYTMLFVAVPILIVALFKDIKKRSIKSKLFLISIVG
FT                   LVLYYSTSIAFGVTYNALHLLYIALFSTSLFTTILLVKNINTKELRRIQKLTLPSKGLT
FT                   IFLTLSGLALFVAWLPDIITSLLNEKSLSLIEVYTTEITYVVDMGIMSPLIFICLYLLK
FT                   KKDGLGDIILAFVLRICEIMGIMLPVQSLFQALAGIELPIPALITKVGIFIILAIFSIY
FT                   FNIKLYKNIEE"
     MERKLKRIDM LITCIIILLI IITLVGACSF QIDKSYMVTN QYGDAVKIFG SGIYAHDSYF        60
     KAPIFIGTDY TMLFVAVPIL IVALFKDIKK RSIKSKLFLI SIVGLVLYYS TSIAFGVTYN       120
     ALHLLYIALF STSLFTTILL VKNINTKELR RIQKLTLPSK GLTIFLTLSG LALFVAWLPD       180
     IITSLLNEKS LSLIEVYTTE ITYVVDMGIM SPLIFICLYL LKKKDGLGDI ILAFVLRICE       240
     IMGIMLPVQS LFQALAGIEL PIPALITKVG IFIILAIFSI YFNIKLYKNI EE               292
//

If you have problems or comments...

PBIL Back to PBIL home page